PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.311420.1
Common NameCsa_3G889150, LOC101207893
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 961aa    MW: 105807 Da    PI: 5.3012
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.311420.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.6e-183985148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l +av  + g++Wk+Ia ++   Rt+ qc +rwqk+l
   Cucsa.311420.1 39 KGQWTPEEDEILRQAVDHFKGKNWKKIAGYFK-DRTDVQCLHRWQKVL 85
                     799****************************9.************986 PP

2Myb_DNA-binding65.59.8e-2191137148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde+++d+v+++G++ W+tIa +++ gR +kqc++rw+++l
   Cucsa.311420.1  91 KGPWSKEEDEIIIDLVNKYGPKKWSTIATHLP-GRIGKQCRERWHNHL 137
                      79******************************.*************97 PP

3Myb_DNA-binding48.71.7e-15143185145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++ +G++ W+   + ++ gRt++ +k++w+
   Cucsa.311420.1 143 KEAWTQEEELALIRAHQIYGNR-WAELTKFLP-GRTDNAIKNHWN 185
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.9643485IPR017930Myb domain
SuperFamilySSF466892.51E-153591IPR009057Homeodomain-like
SMARTSM007171.9E-143887IPR001005SANT/Myb domain
PfamPF002491.1E-153985IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-254197IPR009057Homeodomain-like
CDDcd001676.34E-134285No hitNo description
PROSITE profilePS5129433.36186141IPR017930Myb domain
SuperFamilySSF466892.55E-3188184IPR009057Homeodomain-like
SMARTSM007172.4E-1990139IPR001005SANT/Myb domain
PfamPF002499.5E-1991137IPR001005SANT/Myb domain
CDDcd001675.94E-1793137No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2898141IPR009057Homeodomain-like
PROSITE profilePS5129419.563142192IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-21142192IPR009057Homeodomain-like
SMARTSM007172.2E-15142190IPR001005SANT/Myb domain
PfamPF002491.6E-13143186IPR001005SANT/Myb domain
CDDcd001674.28E-12145185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 961 aa     Download sequence    Send to blast
MEGDKTISTP SDNPEEAVRD QRIRALHGRT SGPTRRSTKG QWTPEEDEIL RQAVDHFKGK  60
NWKKIAGYFK DRTDVQCLHR WQKVLNPELV KGPWSKEEDE IIIDLVNKYG PKKWSTIATH  120
LPGRIGKQCR ERWHNHLNPN INKEAWTQEE ELALIRAHQI YGNRWAELTK FLPGRTDNAI  180
KNHWNSSVKK KLDSYFASGL LSQFQDPVPA GQPNKLPVSS SKVLGSGNDS GLKGMDTEEI  240
SECSQDATVS DSLMIDSACA TLNIRKEFQL TEDLGLGKEQ SASPISNSEP YYRPSMEVST  300
CPIAEFAQEM GHSSHSQQNL SNDCRTTSNR EHQCDLNQFP NISSLQVAKE ASQFQSMGHG  360
MGESHGVGDS AQTSSMIKEA VASAQAECMF ISDDECCRVL FSDTKSDRGH LTSNLKGPCV  420
SEMCDYVVPV HSLGTPKVEN NHTLTPQIYN HPSGTDVQEK NSFGQSGMLI PSMVSVNGDV  480
ILLGGTGSNL FVGAVEHGCV TSQQNRFVYK DGTSKPSYFD VADNPEMQEQ PGGSEDLPKA  540
ICEDTFATAA AEADGTGTCT RLDETAKQND KHLDSRALCY EPPRFPSLDV PFFSCDLIQS  600
GSEMQEYSPL GIRQLMMSSL NSVTPFRLWD SPSRDTSPDA VLKSAAKTFT STPSILKKRH  660
RDLMSPLSER RTDKKLETDV TSSLTENFSR LDVVFNDGSD KASILSPSNL KKSIEDSADN  720
KENMYCTFED SNESQDIMIS ENGFPKRCSQ DYTKQGTADT EMISVRSTSE IVPPGVLAEH  780
DANDLLLHSV DQKALNSSTR IKKRHCLSKS EDASNADNVK QIDSTRPQTT ATGIASLPGA  840
GETPFKRSIE SPSAWMSPWF FNSFLPGPRI DTEISIEDIG YFSSPKERSL DAIGLMKQVS  900
ERTAAACANA HEVLGNETPD TLLKGTRMKH LHCDEAVLAE CRVLDFSECG SPGKVGTMGA  960
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C7e-71391926159MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-71391926159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818240.0LN681824.1 Cucumis melo genomic scaffold, anchoredscaffold01596.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011652549.10.0PREDICTED: myb-related protein 3R-1
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0A0LHI70.0A0A0A0LHI7_CUCSA; Uncharacterized protein
STRINGPOPTR_0018s00710.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]